PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00293.1_g00009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 340aa    MW: 38515.1 Da    PI: 8.6168
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00293.1_g00009.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.62.8e-181461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g W++eEde+l+++++++G g+W+++++  g+ R++k+c++rw +yl
  Rsa1.0_00293.1_g00009.1 14 KGLWSPEEDEKLLNYITRHGHGCWSSVPKLAGLLRCGKSCRLRWINYL 61
                             678*****************************99************97 PP

2Myb_DNA-binding46.39.5e-1567110146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              rg+++++E+ l++++++  G++ W+ Ia +++ gRt++++k++w++
  Rsa1.0_00293.1_g00009.1  67 RGAFSQDEESLIIELHAASGNR-WSQIATRLP-GRTDNEIKNFWNS 110
                              89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-26664IPR009057Homeodomain-like
PROSITE profilePS5129417.911961IPR017930Myb domain
SuperFamilySSF466892.55E-2812108IPR009057Homeodomain-like
SMARTSM007172.2E-131363IPR001005SANT/Myb domain
PfamPF002494.3E-161461IPR001005SANT/Myb domain
CDDcd001673.42E-111761No hitNo description
PROSITE profilePS5129424.6162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-2565116IPR009057Homeodomain-like
SMARTSM007171.0E-1466114IPR001005SANT/Myb domain
PfamPF002491.0E-1367111IPR001005SANT/Myb domain
CDDcd001671.11E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MRSHSCCYKQ KLRKGLWSPE EDEKLLNYIT RHGHGCWSSV PKLAGLLRCG KSCRLRWINY  60
LRPDLKRGAF SQDEESLIIE LHAASGNRWS QIATRLPGRT DNEIKNFWNS CLKKKLRRKG  120
IDPTTHKPLI SDIQTANVID QKLTSSNTSE VVKSTGLINN PHDDQSMAVS SQPGPCWFPE  180
TKTRANQNAA FCFSASTLPT VSDQMTSNFN PVPNNWELNY CSNTVPSHRN SIYSAFFGNH  240
YTEASQIMNN NNNPVMDHHY HQDMKSWPSE ILHYTEHNQS SETGLEAEVK PDIAKYYLGS  300
SASSVSSLNE SAARLLHSSE VDFYGKNLQK LNKMAFNQSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26121165108B-MYB
1h8a_C2e-261111624128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013619430.10.0PREDICTED: transcription factor MYB86-like
SwissprotQ8LPH60.0MYB86_ARATH; Transcription factor MYB86
TrEMBLA0A0D3AXJ40.0A0A0D3AXJ4_BRAOL; Uncharacterized protein
STRINGBra020526.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.10.0myb domain protein 86